Lot-matched COA on file Tesa10
Bulk savings apply automatically in the cart.
Tracked, insured, plain packaging
Most orders ship the same or next business day from Texas.
A person answers your questions
Write to info@kyreon.co. Replies within one business day, usually sooner.
Secure checkout
Card, Apple Pay and Google Pay. Your card details are never stored by us.
Each at $69.00
A synthetic peptide of 44 amino acid residues carrying a trans-3-hexenoyl group at the N-terminus. That acylation is the sole structural difference from the corresponding unmodified native sequence, and it confers resistance to cleavage by dipeptidyl peptidase-4, which acts on the N-terminal dipeptide of the unmodified form.
COMPOSITION
44 amino acid residues, N-terminally acylated · Formula C221H366N72O67S · MW 5,135.9 g/mol · CAS 218949-48-5
ANALYTICAL SPECIFICATION
Identity confirmed by mass spectrometry against the theoretical molecular weight. Purity by reverse-phase HPLC at 214 nm, reported as area percent. Each lot ships with a certificate of analysis matched to its lot number.
FORM AND STORAGE
White to off-white lyophilized powder. Store lyophilized, protected from light. Peptides of this length are more prone to aggregation than short sequences; keep the vial sealed.
Supplied for laboratory research use only. Not for human or veterinary use. No preparation, measurement, handling or application instructions are provided.
- HPLC + MS verified
- COA for every lot
- Tracked, insured shipping
- Secure checkout
Free shipping on orders over $115.
Ships worldwide. International rates calculated at checkout.
Analytical specifications
| Chemical name | Tesa10 |
|---|---|
| Class | Synthetic 44-residue peptide; N-terminally acylated releasing-factor analogue |
| Sequence | (trans-3-Hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂ |
| Molecular weight | 5135.9 g/mol |
| Molecular formula | C₂₂₁H₃₆₆N₇₂O₆₇S |
| CAS number | 218949-48-5 |
| Purity | ≥ 99.45% (HPLC) |
| Identity | Confirmed by mass spectrometry |
| Form | Lyophilized powder |
| Amount | 10 mg per vial |
| Storage | Store lyophilized, protected from light |
| Current lot | KR260709A |
