Skip to content
20% off your first order with code WELCOME20. No minimum.
Back to catalog
Peptides

Tesa10

$69.00 10 mg
In stock
Quantity
2 Save 5%
3 to 4 Save 12%
5 to 9 Save 18%
10+ Save 25%

Bulk savings apply automatically in the cart.

Certificate of analysis Lot KR260709A
Read it →
Purity, HPLC-UV 99.45%
Identity, LC-MS Confirmed
Tested by Independent third-party lab

Tracked, insured, plain packaging

Most orders ship the same or next business day from Texas.

A person answers your questions

Write to info@kyreon.co. Replies within one business day, usually sooner.

Secure checkout

Card, Apple Pay and Google Pay. Your card details are never stored by us.

Volume pricing

Each at $69.00

A synthetic peptide of 44 amino acid residues carrying a trans-3-hexenoyl group at the N-terminus. That acylation is the sole structural difference from the corresponding unmodified native sequence, and it confers resistance to cleavage by dipeptidyl peptidase-4, which acts on the N-terminal dipeptide of the unmodified form.

COMPOSITION

44 amino acid residues, N-terminally acylated · Formula C221H366N72O67S · MW 5,135.9 g/mol · CAS 218949-48-5

ANALYTICAL SPECIFICATION

Identity confirmed by mass spectrometry against the theoretical molecular weight. Purity by reverse-phase HPLC at 214 nm, reported as area percent. Each lot ships with a certificate of analysis matched to its lot number.

FORM AND STORAGE

White to off-white lyophilized powder. Store lyophilized, protected from light. Peptides of this length are more prone to aggregation than short sequences; keep the vial sealed.

Supplied for laboratory research use only. Not for human or veterinary use. No preparation, measurement, handling or application instructions are provided.

  • HPLC + MS verified
  • COA for every lot
  • Tracked, insured shipping
  • Secure checkout

Free shipping on orders over $115.

Ships worldwide. International rates calculated at checkout.

Analytical specifications

Chemical name Tesa10
Class Synthetic 44-residue peptide; N-terminally acylated releasing-factor analogue
Sequence (trans-3-Hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH₂
Molecular weight 5135.9 g/mol
Molecular formula C₂₂₁H₃₆₆N₇₂O₆₇S
CAS number 218949-48-5
Purity ≥ 99.45% (HPLC)
Identity Confirmed by mass spectrometry
Form Lyophilized powder
Amount 10 mg per vial
Storage Store lyophilized, protected from light
Current lot KR260709A